PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G067300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 643aa    MW: 73097 Da    PI: 6.6905
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G067300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.67.5e-1092506211374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+ lL++cA+a++ ++l  a +lL++++++asp+gd  qRla y++ +L+arla+++s++y++l  ++t+    ++ l+a++lf  v+P+ 
  Sevir.3G067300.1.p 250 LRALLIQCAQAIAVNNLPFAGELLKKIRHHASPYGDGSQRLAIYLADGLEARLAGTGSKMYQKLMEKRTR---ATDMLKAYRLFIAVCPFT 337
                         5789***********************************************************9999998...99**************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         ++++   Nq+I++ ++g  +vHiiDf+i+ G+QWp+L+q +a++++gpp+lRiTg++ p+sg     +le+tg+rLa++Ae ++vpf+++ 
  Sevir.3G067300.1.p 338 RVAYYFSNQTIVDVLNGRPKVHIIDFGITLGFQWPSLIQRFAKQEGGPPKLRITGIDVPQSGfrPCATLESTGKRLAEYAEMFNVPFQYQG 428
                         *************************************************************99999************************* PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +++++e++ +++L+++++E+l++n++++ ++l de  +++ +rd+vL+++k+++P+v+++  ++  ++s+ Fl rf e l +ys+lfd+l
  Sevir.3G067300.1.p 429 -ITSQWENICIDNLNIDNDEVLIINCMYRTKYLGDELEDIDCPRDRVLRIMKRINPEVLILGISNGLYSSPFFLPRFREVLFHYSSLFDML 518
                         .799*************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++++ + +eeri +Er llg  + nvvaceg+er+er et+++W+ r  +aGFk++p+++ + k      +k++ + + ++e+sg+l++gW
  Sevir.3G067300.1.p 519 NTTVLQSHEERIRIERDLLGAGALNVVACEGEERIERPETYKQWQVRSLKAGFKQLPINQAILKRSIDEKNKHYHNDFVIDEDSGWLLQGW 609
                         ***************************************************************99988888888788************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r + +vS+W+
  Sevir.3G067300.1.p 610 KGRVMHAVSSWK 621
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.833224601IPR005202Transcription factor GRAS
PfamPF035142.6E-106250621IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MESPEYCEIN SNMTLDYIDQ LLMEDSDEKA SIYQRHDALQ ATEKPFYDIL GQAYPSSPKD  60
TMISTDSQID CLQDSSSSYT KGACSGRFVS DILGPQGMHL VANDWASECD HFSSQFQRAA  120
EEANKLVPSI ERLMVDLDSN GLSDSNQMIG EAIGQKSKHV GKIRSHPHVD LELLEARNSK  180
HLAISASETT RDEMFDSVLL CDWQLHCDAA HLREMKAKEE SNSQQNVQSK RYGHGKVKSR  240
SKKKEEGIDL RALLIQCAQA IAVNNLPFAG ELLKKIRHHA SPYGDGSQRL AIYLADGLEA  300
RLAGTGSKMY QKLMEKRTRA TDMLKAYRLF IAVCPFTRVA YYFSNQTIVD VLNGRPKVHI  360
IDFGITLGFQ WPSLIQRFAK QEGGPPKLRI TGIDVPQSGF RPCATLESTG KRLAEYAEMF  420
NVPFQYQGIT SQWENICIDN LNIDNDEVLI INCMYRTKYL GDELEDIDCP RDRVLRIMKR  480
INPEVLILGI SNGLYSSPFF LPRFREVLFH YSSLFDMLNT TVLQSHEERI RIERDLLGAG  540
ALNVVACEGE ERIERPETYK QWQVRSLKAG FKQLPINQAI LKRSIDEKNK HYHNDFVIDE  600
DSGWLLQGWK GRVMHAVSSW KPKESYTNQK DRSRSSCTNQ LY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-512546218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700241.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK3ZDU30.0K3ZDU3_SETIT; Uncharacterized protein
STRINGSi024734m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-158GRAS family protein